Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (21 species) not a true protein |
Species Nostoc sp. [TaxId:103690] [406962] (2 PDB entries) |
Domain d6t7ea_: 6t7e A: [407148] automated match to d1nzaa_ complexed with mes |
PDB Entry: 6t7e (more details), 2.45 Å
SCOPe Domain Sequences for d6t7ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t7ea_ d.58.5.0 (A:) automated matches {Nostoc sp. [TaxId: 103690]} mkialtnlppehgeriarllveehivacvnlypvhsiyswkgevcseaevtlmmkvstqg ierlkqricelhpyelpefvvievdnnaslreyidfvkgeth
Timeline for d6t7ea_: