Lineage for d6t7ea_ (6t7e A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557730Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2557731Protein automated matches [190753] (21 species)
    not a true protein
  7. 2557885Species Nostoc sp. [TaxId:103690] [406962] (2 PDB entries)
  8. 2557892Domain d6t7ea_: 6t7e A: [407148]
    automated match to d1nzaa_
    complexed with mes

Details for d6t7ea_

PDB Entry: 6t7e (more details), 2.45 Å

PDB Description: pii-like protein cuta from nostoc sp. pcc7120 in complex with mes
PDB Compounds: (A:) Periplasmic divalent cation tolerance protein

SCOPe Domain Sequences for d6t7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t7ea_ d.58.5.0 (A:) automated matches {Nostoc sp. [TaxId: 103690]}
mkialtnlppehgeriarllveehivacvnlypvhsiyswkgevcseaevtlmmkvstqg
ierlkqricelhpyelpefvvievdnnaslreyidfvkgeth

SCOPe Domain Coordinates for d6t7ea_:

Click to download the PDB-style file with coordinates for d6t7ea_.
(The format of our PDB-style files is described here.)

Timeline for d6t7ea_: