Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (10 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries) |
Domain d5s5fb1: 5s5f B:1-245 [407068] Other proteins in same PDB: d5s5fa2, d5s5fb2, d5s5fc2, d5s5fd2, d5s5fe_, d5s5ff1, d5s5ff2, d5s5ff3 automated match to d4drxb1 complexed with acp, ca, gdp, gtp, mes, mg, uqm |
PDB Entry: 5s5f (more details), 2.24 Å
SCOPe Domain Sequences for d5s5fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5s5fb1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d5s5fb1: