Lineage for d2nef__ (2nef -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.102: Regulatory factor Nef [55670] (1 superfamily) Superfamily d.102.1: Regulatory factor Nef [55671] (1 family) 
Family d.102.1.1: Regulatory factor Nef [55672] (1 protein) Protein Regulatory factor Nef [55673] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [55674] (4 PDB entries) 
Domain d2nef__: 2nef - [40704]
Details for d2nef__
PDB Entry: 2nef (more details)
PDB Description: hiv-1 nef (regulatory factor), nmr, 40 structures
SCOP Domain Sequences for d2nef__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nef__ d.102.1.1 (-) Regulatory factor Nef {Human immunodeficiency virus type 1}
awleaqeeeevgfpvtpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiy
htqgyfpdwqnytpgpgirypltfgwcyklvpvepekleeankddperevlewrfdsrla
fhhmarelhpeyfkna
SCOP Domain Coordinates for d2nef__:
Click to download the PDB-style file with coordinates for d2nef__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nef__:
- d2nef__ appears in SCOP 1.57
- d2nef__ appears in the current release, SCOPe 2.08, called d2nefa_
View in 3D