Lineage for d1efnb_ (1efn B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136422Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
  4. 136423Superfamily d.102.1: Regulatory factor Nef [55671] (1 family) (S)
  5. 136424Family d.102.1.1: Regulatory factor Nef [55672] (1 protein)
  6. 136425Protein Regulatory factor Nef [55673] (1 species)
  7. 136426Species Human immunodeficiency virus type 1 [TaxId:11676] [55674] (4 PDB entries)
  8. 136427Domain d1efnb_: 1efn B: [40699]
    Other proteins in same PDB: d1efna_, d1efnc_

Details for d1efnb_

PDB Entry: 1efn (more details), 2.5 Å

PDB Description: hiv-1 nef protein in complex with r96i mutant fyn sh3 domain

SCOP Domain Sequences for d1efnb_:

Sequence, based on SEQRES records: (download)

>d1efnb_ d.102.1.1 (B:) Regulatory factor Nef {Human immunodeficiency virus type 1}
rpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
pgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewrfdsrla
fhhvarelhpeyf

Sequence, based on observed residues (ATOM records): (download)

>d1efnb_ d.102.1.1 (B:) Regulatory factor Nef {Human immunodeficiency virus type 1}
rpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
pgvrypltfgwcyklvpvrevlewrfdsrlafhhvarelhpeyf

SCOP Domain Coordinates for d1efnb_:

Click to download the PDB-style file with coordinates for d1efnb_.
(The format of our PDB-style files is described here.)

Timeline for d1efnb_: