![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) ![]() |
![]() | Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins) |
![]() | Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 [55668] (1 species) duplication of two-domain units formed by domains 1-2 and 4-5 |
![]() | Species Streptomyces antibioticus [TaxId:1890] [55669] (2 PDB entries) |
![]() | Domain d1e3ha6: 1e3h A:483-578 [40696] Other proteins in same PDB: d1e3ha1, d1e3ha2, d1e3ha3, d1e3ha4 complexed with so4 |
PDB Entry: 1e3h (more details), 2.6 Å
SCOP Domain Sequences for d1e3ha6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ha6 d.101.1.1 (A:483-578) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]} apvagiamglisqeingethyvaltdilgaedafgdmdfkvagtkefvtalqldtkldgi pasvlaaalkqardarlhildvmmeaidtpdemspn
Timeline for d1e3ha6: