Lineage for d1e3ha6 (1e3h A:483-578)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608773Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 608774Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 608775Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (2 proteins)
  6. 608776Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 [55668] (1 species)
    duplication of two-domain units formed by domains 1-2 and 4-5
  7. 608777Species Streptomyces antibioticus [TaxId:1890] [55669] (2 PDB entries)
  8. 608779Domain d1e3ha6: 1e3h A:483-578 [40696]
    Other proteins in same PDB: d1e3ha1, d1e3ha2, d1e3ha3, d1e3ha4
    complexed with so4

Details for d1e3ha6

PDB Entry: 1e3h (more details), 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme

SCOP Domain Sequences for d1e3ha6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ha6 d.101.1.1 (A:483-578) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus}
apvagiamglisqeingethyvaltdilgaedafgdmdfkvagtkefvtalqldtkldgi
pasvlaaalkqardarlhildvmmeaidtpdemspn

SCOP Domain Coordinates for d1e3ha6:

Click to download the PDB-style file with coordinates for d1e3ha6.
(The format of our PDB-style files is described here.)

Timeline for d1e3ha6: