SCOP 1.75: Domain d1e3ha5: 1e3h A:152-262

Lineage for d1e3ha5 (1e3h A:152-262)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family)

5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)

6. Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 [55668] (1 species)
   duplication of two-domain units formed by domains 1-2 and 4-5

7. Species Streptomyces antibioticus [TaxId:1890] [55669] (2 PDB entries)

8. Domain d1e3ha5: 1e3h A:152-262 [40695]
   Other proteins in same PDB: d1e3ha1, d1e3ha2, d1e3ha3, d1e3ha4

Details for d1e3ha5

PDB Entry: 1e3h, 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme

PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOP Domain Sequences for d1e3ha5:

Sequence; same for both SEQRES and ATOM records:

>d1e3ha5 d.101.1.1 (A:152-262) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]}
fsgpiggvrvalirgqwvafpthteledavfdmvvagrvledgdvaimmveaeatektiq
lvkdgaeapteevvaagldaakpfikvlckaqadlaakaakptgefpvfld

Timeline for d1e3ha5:

• d1e3ha5 first appeared (with stable ids) in SCOP 1.55
  
• d1e3ha5 appears in SCOP 1.73
  
• d1e3ha5 appears in SCOPe 2.01
  
• d1e3ha5 appears in the current release, SCOPe 2.08