Lineage for d1e3ha5 (1e3h A:152-262)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869404Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 869405Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 869406Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)
  6. 869544Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 [55668] (1 species)
    duplication of two-domain units formed by domains 1-2 and 4-5
  7. 869545Species Streptomyces antibioticus [TaxId:1890] [55669] (2 PDB entries)
  8. 869546Domain d1e3ha5: 1e3h A:152-262 [40695]
    Other proteins in same PDB: d1e3ha1, d1e3ha2, d1e3ha3, d1e3ha4

Details for d1e3ha5

PDB Entry: 1e3h (more details), 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme
PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOP Domain Sequences for d1e3ha5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ha5 d.101.1.1 (A:152-262) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]}
fsgpiggvrvalirgqwvafpthteledavfdmvvagrvledgdvaimmveaeatektiq
lvkdgaeapteevvaagldaakpfikvlckaqadlaakaakptgefpvfld

SCOP Domain Coordinates for d1e3ha5:

Click to download the PDB-style file with coordinates for d1e3ha5.
(The format of our PDB-style files is described here.)

Timeline for d1e3ha5: