Lineage for d1dktb_ (1dkt B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730534Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 730535Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 730536Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 730542Protein CksHs1 [55645] (1 species)
  7. 730543Species Human (Homo sapiens) [TaxId:9606] [55646] (5 PDB entries)
  8. 730547Domain d1dktb_: 1dkt B: [40688]
    complexed with v7o

Details for d1dktb_

PDB Entry: 1dkt (more details), 2.9 Å

PDB Description: ckshs1: human cyclin dependent kinase subunit, type 1 complex with metavanadate
PDB Compounds: (B:) cyclin dependent kinase subunit, type 1

SCOP Domain Sequences for d1dktb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dktb_ d.97.1.1 (B:) CksHs1 {Human (Homo sapiens) [TaxId: 9606]}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrplpk

SCOP Domain Coordinates for d1dktb_:

Click to download the PDB-style file with coordinates for d1dktb_.
(The format of our PDB-style files is described here.)

Timeline for d1dktb_:

730547
d1dktb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1dkta_