SCOPe 2.07: Domain d5sa8a2: 5sa8 A:191-346

Lineage for d5sa8a2 (5sa8 A:191-346)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins)
   PfamB PB001946

6. Protein automated matches [384919] (1 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [384920] (27 PDB entries)

8. Domain d5sa8a2: 5sa8 A:191-346 [406871]
   Other proteins in same PDB: d5sa8a1, d5sa8a3, d5sa8b1, d5sa8b3
   automated match to d2h85a2
   complexed with jov

Details for d5sa8a2

PDB Entry: 5sa8, 2.3 Å

PDB Description: pandda analysis group deposition -- crystal structure of sars-cov-2 nendou in complex with z68299550

PDB Compounds: (A:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d5sa8a2:

Sequence; same for both SEQRES and ATOM records:

>d5sa8a2 d.294.1.2 (A:191-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypklq

Timeline for d5sa8a2:

• d5sa8a2 is new in SCOPe 2.07-stable
  
• d5sa8a2 appears in the current release, SCOPe 2.08