Lineage for d1buhb_ (1buh B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208028Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2208029Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2208030Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2208036Protein CksHs1 [55645] (1 species)
  7. 2208037Species Human (Homo sapiens) [TaxId:9606] [55646] (5 PDB entries)
  8. 2208039Domain d1buhb_: 1buh B: [40686]
    Other proteins in same PDB: d1buha_

Details for d1buhb_

PDB Entry: 1buh (more details), 2.6 Å

PDB Description: crystal structure of the human cdk2 kinase complex with cell cycle-regulatory protein ckshs1
PDB Compounds: (B:) protein (ckshs1 human)

SCOPe Domain Sequences for d1buhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buhb_ d.97.1.1 (B:) CksHs1 {Human (Homo sapiens) [TaxId: 9606]}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrplp

SCOPe Domain Coordinates for d1buhb_:

Click to download the PDB-style file with coordinates for d1buhb_.
(The format of our PDB-style files is described here.)

Timeline for d1buhb_:

2208039
d1buhb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1buha_