Lineage for d1buhb_ (1buh B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34875Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
  4. 34876Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 34877Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 34883Protein CksHs1 [55645] (1 species)
  7. 34884Species Human (Homo sapiens) [TaxId:9606] [55646] (3 PDB entries)
  8. 34885Domain d1buhb_: 1buh B: [40686]
    Other proteins in same PDB: d1buha_

Details for d1buhb_

PDB Entry: 1buh (more details), 2.6 Å

PDB Description: crystal structure of the human cdk2 kinase complex with cell cycle-regulatory protein ckshs1

SCOP Domain Sequences for d1buhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buhb_ d.97.1.1 (B:) CksHs1 {Human (Homo sapiens)}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrplp

SCOP Domain Coordinates for d1buhb_:

Click to download the PDB-style file with coordinates for d1buhb_.
(The format of our PDB-style files is described here.)

Timeline for d1buhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1buha_