Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
Protein CksHs1 [55645] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55646] (3 PDB entries) |
Domain d1buhb_: 1buh B: [40686] Other proteins in same PDB: d1buha_ |
PDB Entry: 1buh (more details), 2.6 Å
SCOP Domain Sequences for d1buhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buhb_ d.97.1.1 (B:) CksHs1 {Human (Homo sapiens)} qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep hillfrrplp
Timeline for d1buhb_: