Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
Protein CksHs2 [55643] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55644] (1 PDB entry) |
Domain d1cksc_: 1cks C: [40685] |
PDB Entry: 1cks (more details), 2.1 Å
SCOP Domain Sequences for d1cksc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cksc_ d.97.1.1 (C:) CksHs2 {Human (Homo sapiens)} ahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihe pephillfrrplpkdqqk
Timeline for d1cksc_: