Lineage for d1cksc_ (1cks C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34875Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
  4. 34876Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 34877Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 34890Protein CksHs2 [55643] (1 species)
  7. 34891Species Human (Homo sapiens) [TaxId:9606] [55644] (1 PDB entry)
  8. 34894Domain d1cksc_: 1cks C: [40685]

Details for d1cksc_

PDB Entry: 1cks (more details), 2.1 Å

PDB Description: human ckshs2 atomic structure: a role for its hexameric assembly in cell cycle control

SCOP Domain Sequences for d1cksc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cksc_ d.97.1.1 (C:) CksHs2 {Human (Homo sapiens)}
ahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihe
pephillfrrplpkdqqk

SCOP Domain Coordinates for d1cksc_:

Click to download the PDB-style file with coordinates for d1cksc_.
(The format of our PDB-style files is described here.)

Timeline for d1cksc_: