Lineage for d1scea_ (1sce A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967083Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2967084Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2967085Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2967105Protein suc1 [55639] (1 species)
  7. 2967106Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries)
    in hexamer, the beta-sheets of three dimers form a barrel, closed: n=12, S=12
  8. 2967108Domain d1scea_: 1sce A: [40676]
    complexed with cl

Details for d1scea_

PDB Entry: 1sce (more details), 2.2 Å

PDB Description: crystal structure of the cell cycle regulatory protein suc1 reveals a novel beta-hinge conformational switch
PDB Compounds: (A:) suc1

SCOPe Domain Sequences for d1scea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scea_ d.97.1.1 (A:) suc1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetgtlri
lqeeewrglgitqslgwemyevhvpephillfkrekd

SCOPe Domain Coordinates for d1scea_:

Click to download the PDB-style file with coordinates for d1scea_.
(The format of our PDB-style files is described here.)

Timeline for d1scea_: