Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
Protein suc1 [55639] (1 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries) in hexamer, the beta-sheets of three dimers form a barrel, closed: n=12, S=12 |
Domain d1scea_: 1sce A: [40676] complexed with cl |
PDB Entry: 1sce (more details), 2.2 Å
SCOPe Domain Sequences for d1scea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1scea_ d.97.1.1 (A:) suc1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} vprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetgtlri lqeeewrglgitqslgwemyevhvpephillfkrekd
Timeline for d1scea_: