Lineage for d1puca_ (1puc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967083Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2967084Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2967085Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2967105Protein suc1 [55639] (1 species)
  7. 2967106Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries)
    in hexamer, the beta-sheets of three dimers form a barrel, closed: n=12, S=12
  8. 2967107Domain d1puca_: 1puc A: [40675]
    complexed with cps

Details for d1puca_

PDB Entry: 1puc (more details), 1.95 Å

PDB Description: p13suc1 in a strand-exchanged dimer
PDB Compounds: (A:) p13suc1

SCOPe Domain Sequences for d1puca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puca_ d.97.1.1 (A:) suc1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetg
tlrilqeeewrglgitqslgwemyevhvpephillfkrekd

SCOPe Domain Coordinates for d1puca_:

Click to download the PDB-style file with coordinates for d1puca_.
(The format of our PDB-style files is described here.)

Timeline for d1puca_: