Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (158 PDB entries) |
Domain d5s4nf2: 5s4n F:77-378 [406746] Other proteins in same PDB: d5s4na1, d5s4na2, d5s4nb1, d5s4nb2, d5s4nc1, d5s4nc2, d5s4nd1, d5s4nd2, d5s4ne_, d5s4nf1, d5s4nf3 automated match to d3tiia2 complexed with acp, ca, gdp, gtp, mes, mg, uva |
PDB Entry: 5s4n (more details), 2.53 Å
SCOPe Domain Sequences for d5s4nf2:
Sequence, based on SEQRES records: (download)
>d5s4nf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5s4nf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnltderevflaaynrrregnvwiakssagagil isseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvl rtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttlen sillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqk lyaelcqgivdvaissvfplaptsifikl
Timeline for d5s4nf2: