Lineage for d1uox_2 (1uox 137-295)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332602Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 332603Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 332723Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)
  6. 332724Protein Urate oxidase (uricase) [55634] (1 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. 332725Species Aspergillus flavus [TaxId:5059] [55635] (1 PDB entry)
  8. 332727Domain d1uox_2: 1uox 137-295 [40674]
    complexed with ace, aza, fcy

Details for d1uox_2

PDB Entry: 1uox (more details), 2 Å

PDB Description: urate oxidase from aspergillus flavus complexed with its inhibitor 8-azaxanthine

SCOP Domain Sequences for d1uox_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uox_2 d.96.1.4 (137-295) Urate oxidase (uricase) {Aspergillus flavus}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs

SCOP Domain Coordinates for d1uox_2:

Click to download the PDB-style file with coordinates for d1uox_2.
(The format of our PDB-style files is described here.)

Timeline for d1uox_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uox_1