SCOPe 2.07: Domain d5s5td1: 5s5t D:1-245

Lineage for d5s5td1 (5s5t D:1-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries)

8. Domain d5s5td1: 5s5t D:1-245 [406639]
   Other proteins in same PDB: d5s5ta2, d5s5tb2, d5s5tc2, d5s5td2, d5s5te_, d5s5tf1, d5s5tf2, d5s5tf3
   automated match to d4drxb1
   complexed with acp, ca, gdp, gtp, mes, mg, o1m

Details for d5s5td1

PDB Entry: 5s5t, 2.53 Å

PDB Description: tubulin-z198194394-complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5s5td1:

Sequence; same for both SEQRES and ATOM records:

>d5s5td1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d5s5td1:

• d5s5td1 is new in SCOPe 2.07-stable
  
• d5s5td1 appears in the current release, SCOPe 2.08