Lineage for d7oj5l1 (7oj5 L:78-163)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2538081Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2538082Protein automated matches [190826] (22 species)
    not a true protein
  7. 2538218Species Medicago truncatula [TaxId:3880] [406142] (1 PDB entry)
  8. 2538230Domain d7oj5l1: 7oj5 L:78-163 [406546]
    Other proteins in same PDB: d7oj5a2, d7oj5b2, d7oj5c2, d7oj5d2, d7oj5e2, d7oj5f2, d7oj5g2, d7oj5h2, d7oj5i2, d7oj5j2, d7oj5k2, d7oj5l2, d7oj5m2, d7oj5n2, d7oj5o2, d7oj5p2, d7oj5q2, d7oj5r2, d7oj5s2, d7oj5t2, d7oj5v2, d7oj5w2, d7oj5x2, d7oj5y2
    automated match to d5el9a1
    complexed with mn

Details for d7oj5l1

PDB Entry: 7oj5 (more details), 2.4 Å

PDB Description: cryo-em structure of medicago truncatula hisn5 protein
PDB Compounds: (L:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d7oj5l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7oj5l1 d.14.1.0 (L:78-163) automated matches {Medicago truncatula [TaxId: 3880]}
arigemkrvtketnvsvkinldgtgvadnssgipfldhmldqlashglfdvhvkatgdth
iddhhtnedvalaigtallqalgdrk

SCOPe Domain Coordinates for d7oj5l1:

Click to download the PDB-style file with coordinates for d7oj5l1.
(The format of our PDB-style files is described here.)

Timeline for d7oj5l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7oj5l2
View in 3D
Domains from other chains:
(mouse over for more information)
d7oj5a1, d7oj5a2, d7oj5b1, d7oj5b2, d7oj5c1, d7oj5c2, d7oj5d1, d7oj5d2, d7oj5e1, d7oj5e2, d7oj5f1, d7oj5f2, d7oj5g1, d7oj5g2, d7oj5h1, d7oj5h2, d7oj5i1, d7oj5i2, d7oj5j1, d7oj5j2, d7oj5k1, d7oj5k2, d7oj5m1, d7oj5m2, d7oj5n1, d7oj5n2, d7oj5o1, d7oj5o2, d7oj5p1, d7oj5p2, d7oj5q1, d7oj5q2, d7oj5r1, d7oj5r2, d7oj5s1, d7oj5s2, d7oj5t1, d7oj5t2, d7oj5v1, d7oj5v2, d7oj5w1, d7oj5w2, d7oj5x1, d7oj5x2, d7oj5y1, d7oj5y2