Lineage for d5s4ue_ (5s4u E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346952Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2346953Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2346954Protein Stathmin 4 [101496] (3 species)
  7. 2346971Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries)
  8. 2347018Domain d5s4ue_: 5s4u E: [406506]
    Other proteins in same PDB: d5s4ua1, d5s4ua2, d5s4ub1, d5s4ub2, d5s4uc1, d5s4uc2, d5s4ud1, d5s4ud2, d5s4uf1, d5s4uf2, d5s4uf3
    automated match to d4i55e_
    complexed with acp, ca, gdp, gtp, gx4, mes, mg

Details for d5s4ue_

PDB Entry: 5s4u (more details), 2.39 Å

PDB Description: tubulin-z30620520-complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5s4ue_:

Sequence, based on SEQRES records: (download)

>d5s4ue_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d5s4ue_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d5s4ue_:

Click to download the PDB-style file with coordinates for d5s4ue_.
(The format of our PDB-style files is described here.)

Timeline for d5s4ue_: