Lineage for d7ok7f_ (7ok7 F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2474876Protein ADP-ribosylation factor [52614] (16 species)
  7. 2474947Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (6 PDB entries)
  8. 2474959Domain d7ok7f_: 7ok7 F: [406393]
    Other proteins in same PDB: d7ok7b2, d7ok7c2
    automated match to d4zi2b_
    complexed with edo, gnp, gol, mg, po4

Details for d7ok7f_

PDB Entry: 7ok7 (more details), 3.15 Å

PDB Description: crystal structure of the unc119b arl3 complex
PDB Compounds: (F:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d7ok7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ok7f_ c.37.1.8 (F:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
llsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfk
lnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvl
ifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnakkk

SCOPe Domain Coordinates for d7ok7f_:

Click to download the PDB-style file with coordinates for d7ok7f_.
(The format of our PDB-style files is described here.)

Timeline for d7ok7f_: