Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (158 PDB entries) |
Domain d5s5jf2: 5s5j F:77-378 [406358] Other proteins in same PDB: d5s5ja1, d5s5ja2, d5s5jb1, d5s5jb2, d5s5jc1, d5s5jc2, d5s5jd1, d5s5jd2, d5s5je_, d5s5jf1, d5s5jf3 automated match to d3tiia2 complexed with acp, ca, gdp, gtp, mes, mg, wky |
PDB Entry: 5s5j (more details), 2.25 Å
SCOPe Domain Sequences for d5s5jf2:
Sequence, based on SEQRES records: (download)
>d5s5jf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5s5jf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnltderevflaaynrrregregnvwiakssaga gilisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyre gvlrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalntt lensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapac aqklyaelcqgivdvaissvfplaptsifikl
Timeline for d5s5jf2: