Lineage for d7oj5w2 (7oj5 W:164-261)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537899Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
    duplication; there are two structural repeats of this fold
  6. 2537922Protein automated matches [254526] (2 species)
    not a true protein
  7. 2537923Species Medicago truncatula [TaxId:3880] [406144] (1 PDB entry)
  8. 2537945Domain d7oj5w2: 7oj5 W:164-261 [406198]
    Other proteins in same PDB: d7oj5a1, d7oj5b1, d7oj5c1, d7oj5d1, d7oj5e1, d7oj5f1, d7oj5g1, d7oj5h1, d7oj5i1, d7oj5j1, d7oj5k1, d7oj5l1, d7oj5m1, d7oj5n1, d7oj5o1, d7oj5p1, d7oj5q1, d7oj5r1, d7oj5s1, d7oj5t1, d7oj5v1, d7oj5w1, d7oj5x1, d7oj5y1
    automated match to d4mu0a2
    complexed with mn

Details for d7oj5w2

PDB Entry: 7oj5 (more details), 2.4 Å

PDB Description: cryo-em structure of medicago truncatula hisn5 protein
PDB Compounds: (W:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d7oj5w2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7oj5w2 d.14.1.9 (W:164-261) automated matches {Medicago truncatula [TaxId: 3880]}
ginrfgnfsapldealvhvsldlsgrphlgydlniptqrvgkydtqlvehffqslvntsg
mtlhirqfsgtnshhiieatfkafaralrqateydtrr

SCOPe Domain Coordinates for d7oj5w2:

Click to download the PDB-style file with coordinates for d7oj5w2.
(The format of our PDB-style files is described here.)

Timeline for d7oj5w2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7oj5w1
View in 3D
Domains from other chains:
(mouse over for more information)
d7oj5a1, d7oj5a2, d7oj5b1, d7oj5b2, d7oj5c1, d7oj5c2, d7oj5d1, d7oj5d2, d7oj5e1, d7oj5e2, d7oj5f1, d7oj5f2, d7oj5g1, d7oj5g2, d7oj5h1, d7oj5h2, d7oj5i1, d7oj5i2, d7oj5j1, d7oj5j2, d7oj5k1, d7oj5k2, d7oj5l1, d7oj5l2, d7oj5m1, d7oj5m2, d7oj5n1, d7oj5n2, d7oj5o1, d7oj5o2, d7oj5p1, d7oj5p2, d7oj5q1, d7oj5q2, d7oj5r1, d7oj5r2, d7oj5s1, d7oj5s2, d7oj5t1, d7oj5t2, d7oj5v1, d7oj5v2, d7oj5x1, d7oj5x2, d7oj5y1, d7oj5y2