Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins) duplication; there are two structural repeats of this fold |
Protein automated matches [254526] (2 species) not a true protein |
Species Medicago truncatula [TaxId:3880] [406144] (1 PDB entry) |
Domain d7oj5d2: 7oj5 D:164-261 [406159] Other proteins in same PDB: d7oj5a1, d7oj5b1, d7oj5c1, d7oj5d1, d7oj5e1, d7oj5f1, d7oj5g1, d7oj5h1, d7oj5i1, d7oj5j1, d7oj5k1, d7oj5l1, d7oj5m1, d7oj5n1, d7oj5o1, d7oj5p1, d7oj5q1, d7oj5r1, d7oj5s1, d7oj5t1, d7oj5v1, d7oj5w1, d7oj5x1, d7oj5y1 automated match to d4mu0a2 complexed with mn |
PDB Entry: 7oj5 (more details), 2.4 Å
SCOPe Domain Sequences for d7oj5d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7oj5d2 d.14.1.9 (D:164-261) automated matches {Medicago truncatula [TaxId: 3880]} ginrfgnfsapldealvhvsldlsgrphlgydlniptqrvgkydtqlvehffqslvntsg mtlhirqfsgtnshhiieatfkafaralrqateydtrr
Timeline for d7oj5d2:
View in 3D Domains from other chains: (mouse over for more information) d7oj5a1, d7oj5a2, d7oj5b1, d7oj5b2, d7oj5c1, d7oj5c2, d7oj5e1, d7oj5e2, d7oj5f1, d7oj5f2, d7oj5g1, d7oj5g2, d7oj5h1, d7oj5h2, d7oj5i1, d7oj5i2, d7oj5j1, d7oj5j2, d7oj5k1, d7oj5k2, d7oj5l1, d7oj5l2, d7oj5m1, d7oj5m2, d7oj5n1, d7oj5n2, d7oj5o1, d7oj5o2, d7oj5p1, d7oj5p2, d7oj5q1, d7oj5q2, d7oj5r1, d7oj5r2, d7oj5s1, d7oj5s2, d7oj5t1, d7oj5t2, d7oj5v1, d7oj5v2, d7oj5w1, d7oj5w2, d7oj5x1, d7oj5x2, d7oj5y1, d7oj5y2 |