| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
| Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
| Species Pig (Sus scrofa) [TaxId:9823] [46555] (9 PDB entries) |
| Domain d7m32a1: 7m32 A:3-183 [405930] Other proteins in same PDB: d7m32a2, d7m32a3, d7m32a4, d7m32a5, d7m32b2, d7m32b3, d7m32b4, d7m32b5, d7m32c2, d7m32c3, d7m32c4, d7m32c5, d7m32d2, d7m32d3, d7m32d4, d7m32d5 automated match to d1h7xb1 complexed with ala, fad, fnr, leu, pro, sf4, ura; mutant |
PDB Entry: 7m32 (more details), 1.82 Å
SCOPe Domain Sequences for d7m32a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7m32a1 a.1.2.2 (A:3-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
pvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfddi
khttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnpl
gltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqekm
p
Timeline for d7m32a1:
View in 3DDomains from same chain: (mouse over for more information) d7m32a2, d7m32a3, d7m32a4, d7m32a5 |