Lineage for d7nkgc_ (7nkg C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561884Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2561885Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2561922Protein automated matches [320245] (3 species)
    not a true protein
  7. 2561935Species Methermicoccus shengliensis [TaxId:1122233] [405898] (1 PDB entry)
  8. 2561936Domain d7nkgc_: 7nkg C: [405910]
    Other proteins in same PDB: d7nkga1, d7nkga2, d7nkgb1, d7nkgb2, d7nkgd1, d7nkgd2, d7nkge1, d7nkge2, d7nkgg1, d7nkgg2, d7nkgh1, d7nkgh2, d7nkgj1, d7nkgj2, d7nkgk1, d7nkgk2
    automated match to d1e6yc_
    complexed with com, f43, gol, k, so4, tp7

Details for d7nkgc_

PDB Entry: 7nkg (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methermicoccus shengliensis at 1.6-a resolution
PDB Compounds: (C:) Methyl-coenzyme M reductase gamma subunit

SCOPe Domain Sequences for d7nkgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nkgc_ d.58.31.1 (C:) automated matches {Methermicoccus shengliensis [TaxId: 1122233]}
ayepqyypgntsvaqnrrkhmsgnveklreisdedltailghrapgsdypsthpplaemg
epdcpireiveptpgaaagdriryvqwtdsmynapatpywrsyyaainhrgvdpgtlsgr
qivearerdvevygkmsietemtcpalaglrgatvhghscrlqedgvmfdmldrrrlegg
tiimdkdqvgvpldrkvdlgkpmseeeaakrttiyrvdnvpfrsdsevvewvqriwelrt
rygfqpq

SCOPe Domain Coordinates for d7nkgc_:

Click to download the PDB-style file with coordinates for d7nkgc_.
(The format of our PDB-style files is described here.)

Timeline for d7nkgc_: