SCOPe 2.07: Domain d7njeb2: 7nje B:92-178

Lineage for d7njeb2 (7nje B:92-178)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein automated matches [254533] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255181] (5 PDB entries)

8. Domain d7njeb2: 7nje B:92-178 [405818]
   automated match to d1zwma2
   mutant

Details for d7njeb2

PDB Entry: 7nje, 3 Å

PDB Description: gamma(s)-crystallin 9-site deamidation mutant grown inside hare serial crystallography chip

PDB Compounds: (B:) Gamma-crystallin S

SCOPe Domain Sequences for d7njeb2:

Sequence; same for both SEQRES and ATOM records:

>d7njeb2 b.11.1.1 (B:92-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geykiqifekgdfsgemyettedcpsimeefhmreihsckvlegvwifyelpdyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive

Timeline for d7njeb2:

• d7njeb2 is new in SCOPe 2.07-stable
  
• d7njeb2 appears in the current release, SCOPe 2.08