SCOPe 2.07: Domain d7n0se1: 7n0s E:-1-127

Lineage for d7n0se1 (7n0s E:-1-127)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d7n0se1: 7n0s E:-1-127 [405679]
   Other proteins in same PDB: d7n0se2, d7n0sf2
   automated match to d5c1mb_
   protein/RNA complex

Details for d7n0se1

PDB Entry: 7n0s, 2.56 Å

PDB Description: structure of the sars-cov-2 n protein rna-binding domain bound to single-domain antibody b6

PDB Compounds: (E:) Single-domain antibody B6

SCOPe Domain Sequences for d7n0se1:

Sequence; same for both SEQRES and ATOM records:

>d7n0se1 b.1.1.1 (E:-1-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
maevqlqasggglvqagdslrlscvavsgrtistfamgwfrqapgkerefvatinwsgss
aryadpvegrftisrddakntvylemsslkpgdsavyycasgrylggitsysqgdfapwg
qgtqvtvss

Timeline for d7n0se1:

• d7n0se1 is new in SCOPe 2.07-stable
  
• d7n0se1 does not appear in SCOPe 2.08