SCOPe 2.07: Domain d7my3d1: 7my3 D:1-111

Lineage for d7my3d1 (7my3 D:1-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d7my3d1: 7my3 D:1-111 [405671]
   Other proteins in same PDB: d7my3d2, d7my3e2, d7my3h2
   automated match to d4krmb_
   complexed with nag

Details for d7my3d1

PDB Entry: 7my3, 2.9 Å

PDB Description: cryoem structure of neutralizing nanobody nb12 in complex with sars- cov2 spike

PDB Compounds: (D:) Nanobody Nb12

SCOPe Domain Sequences for d7my3d1:

Sequence; same for both SEQRES and ATOM records:

>d7my3d1 b.1.1.1 (D:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvkleesgggsvqaggslrlictapglthnncgldwyrrapgkerefvssisadgttsya
dsvkgrftiskdkvedtvylqmnslkpedtaiyscktafpyfgnscvldywgqgtsvtv

Timeline for d7my3d1:

• d7my3d1 is new in SCOPe 2.07-stable
  
• d7my3d1 appears in the current release, SCOPe 2.08