Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d7my3d1: 7my3 D:1-111 [405671] Other proteins in same PDB: d7my3d2, d7my3e2, d7my3h2 automated match to d4krmb_ complexed with nag |
PDB Entry: 7my3 (more details), 2.9 Å
SCOPe Domain Sequences for d7my3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7my3d1 b.1.1.1 (D:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvkleesgggsvqaggslrlictapglthnncgldwyrrapgkerefvssisadgttsya dsvkgrftiskdkvedtvylqmnslkpedtaiyscktafpyfgnscvldywgqgtsvtv
Timeline for d7my3d1:
View in 3D Domains from other chains: (mouse over for more information) d7my3e1, d7my3e2, d7my3h1, d7my3h2 |