Lineage for d1qr5a_ (1qr5 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82634Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily)
  4. 82635Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) (S)
  5. 82636Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein)
  6. 82637Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species)
  7. 82665Species Staphylococcus carnosus [TaxId:1281] [55602] (1 PDB entry)
  8. 82666Domain d1qr5a_: 1qr5 A: [40566]

Details for d1qr5a_

PDB Entry: 1qr5 (more details)

PDB Description: solution structure of histidine containing protein (hpr) from staphylococcus carnosus

SCOP Domain Sequences for d1qr5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr5a_ d.94.1.1 (A:) Histidine-containing phosphocarrier proteins (HPr) {Staphylococcus carnosus}
meqqsytiidetgiharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
itiyadgsdeadaiqaitdvlskeglte

SCOP Domain Coordinates for d1qr5a_:

Click to download the PDB-style file with coordinates for d1qr5a_.
(The format of our PDB-style files is described here.)

Timeline for d1qr5a_: