SCOPe 2.07: Domain d7ms5b_: 7ms5 B:

Lineage for d7ms5b_ (7ms5 B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.5: Zf-UBP [161204] (4 proteins)
   Pfam PF02148

6. Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161208] (9 PDB entries)
   Uniprot P45974 169-285

8. Domain d7ms5b_: 7ms5 B: [405652]
   automated match to d2g45a_
   complexed with ca, edo, zn, zog

Details for d7ms5b_

PDB Entry: 7ms5, 1.98 Å

PDB Description: structure of usp5 zinc-finger ubiquitin binding domain co-crystallized with 4-(4-(4-(3,4-difluoro-phenyl)-piperidin-1-ylsulfonyl)-phenyl)-4- oxo-butanoic acid

PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d7ms5b_:

Sequence; same for both SEQRES and ATOM records:

>d7ms5b_ g.44.1.5 (B:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt

Timeline for d7ms5b_:

• d7ms5b_ is new in SCOPe 2.07-stable
  
• d7ms5b_ appears in the current release, SCOPe 2.08