Lineage for d1zer__ (1zer -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260502Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 260503Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 260504Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 260508Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species)
  7. 260541Species Staphylococcus aureus [TaxId:1280] [55601] (1 PDB entry)
  8. 260542Domain d1zer__: 1zer - [40565]

Details for d1zer__

PDB Entry: 1zer (more details)

PDB Description: the solution structure of the histidine-containing protein (hpr) from staphylococcus aureus as determined by two-dimensional 1h-nmr spectroscopy

SCOP Domain Sequences for d1zer__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zer__ d.94.1.1 (-) Histidine-containing phosphocarrier protein (HPr) {Staphylococcus aureus}
meqnsyviidetgiharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
itiyadgsdesdaiqaisdvlskeglt

SCOP Domain Coordinates for d1zer__:

Click to download the PDB-style file with coordinates for d1zer__.
(The format of our PDB-style files is described here.)

Timeline for d1zer__: