Lineage for d1hdn__ (1hdn -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) 
Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) 
Species Escherichia coli [TaxId:562] [55599] (11 PDB entries) 
Domain d1hdn__: 1hdn - [40562]
Details for d1hdn__
PDB Entry: 1hdn (more details)
PDB Description: the high-resolution structure of the histidine-containing phosphocarrier protein hpr from escherichia coli determined by restrained molecular dynamics from nmr nuclear overhauser effect data
SCOP Domain Sequences for d1hdn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdn__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele
SCOP Domain Coordinates for d1hdn__:
Click to download the PDB-style file with coordinates for d1hdn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hdn__:
- d1hdn__ appears in SCOP 1.57
- d1hdn__ appears in the current release, SCOPe 2.08, called d1hdna_
View in 3D