![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) |
![]() | Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) ![]() |
![]() | Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) |
![]() | Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) |
![]() | Species Escherichia coli [TaxId:562] [55599] (11 PDB entries) |
![]() | Domain d1hdn__: 1hdn - [40562] |
PDB Entry: 1hdn (more details)
SCOP Domain Sequences for d1hdn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdn__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli} mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv vtisaegedeqkavehlvklmaele
Timeline for d1hdn__: