Lineage for d1pfha_ (1pfh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965911Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2965912Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2965913Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2965930Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2965957Species Escherichia coli [TaxId:562] [55599] (23 PDB entries)
  8. 2965985Domain d1pfha_: 1pfh A: [40561]

Details for d1pfha_

PDB Entry: 1pfh (more details)

PDB Description: the phosphorylated form of the histidine-containing phosphocarrier protein hpr
PDB Compounds: (A:) phospho-hpr

SCOPe Domain Sequences for d1pfha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfha_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOPe Domain Coordinates for d1pfha_:

Click to download the PDB-style file with coordinates for d1pfha_.
(The format of our PDB-style files is described here.)

Timeline for d1pfha_: