SCOPe 2.07: Domain d6m60b_: 6m60 B:

Lineage for d6m60b_ (6m60 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (62 PDB entries)

8. Domain d6m60b_: 6m60 B: [405584]
   Other proteins in same PDB: d6m60a_
   automated match to d5uwsb_
   complexed with cl, dms, f2x, gol, gtp, mg, no3

Details for d6m60b_

PDB Entry: 6m60, 2.17 Å

PDB Description: plumbagin in complex with crm1#-ran-ranbp1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d6m60b_:

Sequence; same for both SEQRES and ATOM records:

>d6m60b_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkicanhi
iapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeink
k

Timeline for d6m60b_:

• d6m60b_ is new in SCOPe 2.07-stable
  
• d6m60b_ appears in the current release, SCOPe 2.08