Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries) |
Domain d7m32d2: 7m32 D:184-287,D:441-532 [405568] Other proteins in same PDB: d7m32a1, d7m32a3, d7m32a4, d7m32a5, d7m32b1, d7m32b3, d7m32b4, d7m32b5, d7m32c1, d7m32c3, d7m32c4, d7m32c5, d7m32d1, d7m32d3, d7m32d4, d7m32d5 automated match to d1h7xb4 complexed with ala, fad, fnr, leu, pro, sf4, ura; mutant |
PDB Entry: 7m32 (more details), 1.82 Å
SCOPe Domain Sequences for d7m32d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7m32d2 c.4.1.1 (D:184-287,D:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv sakpelplfytpvdlvd
Timeline for d7m32d2:
View in 3D Domains from same chain: (mouse over for more information) d7m32d1, d7m32d3, d7m32d4, d7m32d5 |