| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) |
Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) ![]() |
| Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) |
| Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) |
| Species Escherichia coli [TaxId:562] [55599] (11 PDB entries) |
| Domain d3ezbb_: 3ezb B: [40556] Other proteins in same PDB: d3ezba1, d3ezba2 |
PDB Entry: 3ezb (more details)
SCOP Domain Sequences for d3ezbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezbb_ d.94.1.1 (B:) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele
Timeline for d3ezbb_: