SCOP 1.69: Domain d3ezab_: 3eza B:

Lineage for d3ezab_ (3eza B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species)

7. Species Escherichia coli [TaxId:562] [55599] (12 PDB entries)

8. Domain d3ezab_: 3eza B: [40555]
   Other proteins in same PDB: d3ezaa1, d3ezaa2

Details for d3ezab_

PDB Entry: 3eza

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d3ezab_:

Sequence; same for both SEQRES and ATOM records:

>d3ezab_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d3ezab_:

• d3ezab_ first appeared (with stable ids) in SCOP 1.55
  
• d3ezab_ appears in SCOP 1.67
  
• d3ezab_ appears in SCOP 1.71
  
• d3ezab_ appears in the current release, SCOPe 2.08