SCOPe 2.07: Domain d7ludl1: 7lud L:1-106

Lineage for d7ludl1 (7lud L:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d7ludl1: 7lud L:1-106 [405522]
   Other proteins in same PDB: d7ludb2, d7ludl2
   automated match to d1dn0a1
   complexed with so4

Details for d7ludl1

PDB Entry: 7lud, 2.9 Å

PDB Description: crystal structure of fab adi-14442

PDB Compounds: (L:) ADI-14442 Fab Light chain

SCOPe Domain Sequences for d7ludl1:

Sequence; same for both SEQRES and ATOM records:

>d7ludl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvmtqsplslpvtlgqpasiscrssqslvhsdtntylnwfqqrpgqsprrliykvsnrd
sgvpdrfsgsgsgttftlkisrveaedvgiyycmqgshwaptfgqgtkvei

Timeline for d7ludl1:

• d7ludl1 is new in SCOPe 2.07-stable
  
• d7ludl1 appears in the current release, SCOPe 2.08