Lineage for d7kw1a_ (7kw1 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617666Fold d.387: STING C-terminal-like [254119] (1 superfamily)
    5 helices and 5 strands in one mixed beta-sheet, one long bent helix
  4. 2617667Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) (S)
    Pfam PF15009, PubMed 22579474
  5. 2617668Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)
  6. 2617669Protein Tyrosinase cofactor MelC1 [254420] (1 species)
  7. 2617670Species Human (Homo sapiens) [TaxId:9606] [254863] (47 PDB entries)
  8. 2617683Domain d7kw1a_: 7kw1 A: [405444]
    automated match to d4f5wa_
    complexed with x4m

Details for d7kw1a_

PDB Entry: 7kw1 (more details), 1.8 Å

PDB Description: structure of hsting in complex with novel carbocyclic pyrimidine cdn-3
PDB Compounds: (A:) Stimulator of interferon genes protein

SCOPe Domain Sequences for d7kw1a_:

Sequence, based on SEQRES records: (download)

>d7kw1a_ d.387.1.1 (A:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
nfnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdn
lsmadpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfam
sqysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlr
hlrq

Sequence, based on observed residues (ATOM records): (download)

>d7kw1a_ d.387.1.1 (A:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
nfnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdn
lsmadpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfam
sqysqagfsredrleqaklfcrtlediladapesqnncrliayqesfslsqevlrhlrq

SCOPe Domain Coordinates for d7kw1a_:

Click to download the PDB-style file with coordinates for d7kw1a_.
(The format of our PDB-style files is described here.)

Timeline for d7kw1a_: