SCOPe 2.08: Domain d6l4qa1: 6l4q A:79-228

Lineage for d6l4qa1 (6l4q A:79-228)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [234564] (7 PDB entries)

8. Domain d6l4qa1: 6l4q A:79-228 [405440]
   Other proteins in same PDB: d6l4qa2, d6l4qb2
   automated match to d3bjua1
   protein/RNA complex; complexed with e5r, lys

Details for d6l4qa1

PDB Entry: 6l4q, 3.1 Å

PDB Description: crystal structure of lysyl-trna synthetase from plasmodium falciparum complexed with l-lysine and clado-b

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6l4qa1:

Sequence; same for both SEQRES and ATOM records:

>d6l4qa1 b.40.4.0 (A:79-228) automated matches {Plasmodium falciparum [TaxId: 36329]}
dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
imrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgk
skkgelsifpketillsaclhmlpmkyglk

Timeline for d6l4qa1:

• d6l4qa1 first appeared in SCOPe 2.07