SCOPe 2.07: Domain d7kjsb1: 7kjs B:88-227

Lineage for d7kjsb1 (7kjs B:88-227)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d7kjsb1: 7kjs B:88-227 [405413]
   Other proteins in same PDB: d7kjsa_
   automated match to d1w98b2
   complexed with wg1

Details for d7kjsb1

PDB Entry: 7kjs, 2.19 Å

PDB Description: crystal structure of cdk2/cyclin e in complex with pf-06873600

PDB Compounds: (B:) G1/S-specific cyclin-E1

SCOPe Domain Sequences for d7kjsb1:

Sequence, based on SEQRES records:

>d7kjsb1 a.74.1.1 (B:88-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
splpvlswanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmevcevyklh
retfylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfayvtdgacs
gdeiltmelmimkalkwrls

Sequence, based on observed residues (ATOM records):

>d7kjsb1 a.74.1.1 (B:88-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
splpanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmevcevyklhretf
ylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfayvtdgacsgdei
ltmelmimkalkwrls

Timeline for d7kjsb1:

• d7kjsb1 is new in SCOPe 2.07-stable
  
• d7kjsb1 appears in the current release, SCOPe 2.08