Lineage for d1d1zc_ (1d1z C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194873Fold d.93: SH2-like [55549] (1 superfamily)
  4. 194874Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 194875Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 195043Protein The Xlp protein Sap [55591] (1 species)
  7. 195044Species Human (Homo sapiens) [TaxId:9606] [55592] (5 PDB entries)
  8. 195048Domain d1d1zc_: 1d1z C: [40540]

Details for d1d1zc_

PDB Entry: 1d1z (more details), 1.4 Å

PDB Description: crystal structure of the xlp protein sap

SCOP Domain Sequences for d1d1zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1zc_ d.93.1.1 (C:) The Xlp protein Sap {Human (Homo sapiens)}
vavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetgs
wsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek

SCOP Domain Coordinates for d1d1zc_:

Click to download the PDB-style file with coordinates for d1d1zc_.
(The format of our PDB-style files is described here.)

Timeline for d1d1zc_: