SCOP 1.65: Domain d1d4ta_: 1d4t A:

Lineage for d1d4ta_ (1d4t A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (25 proteins)

6. Protein The Xlp protein Sap [55591] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55592] (6 PDB entries)

8. Domain d1d4ta_: 1d4t A: [40537]
   complex with a slam peptide

Details for d1d4ta_

PDB Entry: 1d4t, 1.1 Å

PDB Description: crystal structure of the xlp protein sap in complex with a slam peptide

SCOP Domain Sequences for d1d4ta_:

Sequence; same for both SEQRES and ATOM records:

>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens)}
mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek

Timeline for d1d4ta_:

• d1d4ta_ first appeared (with stable ids) in SCOP 1.55
  
• d1d4ta_ appears in SCOP 1.63
  
• d1d4ta_ appears in SCOP 1.67
  
• d1d4ta_ appears in the current release, SCOPe 2.08