![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein The Xlp protein Sap [55591] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55592] (6 PDB entries) |
![]() | Domain d1d4ta_: 1d4t A: [40537] complex with a slam peptide |
PDB Entry: 1d4t (more details), 1.1 Å
SCOPe Domain Sequences for d1d4ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
Timeline for d1d4ta_: