Lineage for d7kb1c_ (7kb1 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505699Species Thermotoga maritima [TaxId:243274] [230690] (4 PDB entries)
  8. 2505706Domain d7kb1c_: 7kb1 C: [405369]
    automated match to d4oc9b_
    complexed with mg, na, pge, plp, wbj

Details for d7kb1c_

PDB Entry: 7kb1 (more details), 1.85 Å

PDB Description: complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate
PDB Compounds: (C:) O-acetyl-L-homoserine sulfhydrylase

SCOPe Domain Sequences for d7kb1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kb1c_ c.67.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 243274]}
dwkkygyntralhagyeppeqatgsravpiyqttsyvfrdsdhaarlfaleepgfiytri
gnptvsvleeriaaleegvgalavasgqaaityailniagpgdeivsgsalyggtynlfr
htlykksgiivkfvdetdpknieeaitektkavyletignpgltvpdfeaiaeiahrhgv
plivdntvapyifrpfehgadivvysatkfigghgtsigglivdsgkfdwtngkfpelve
pdpsyhgvsyvetfkeaayiakcrtqllrdlgscmspfnaflfilgletlslrmkkhcen
alkiveflkshpavswvnypiaegnktrenalkylkegygaivtfgvkggkeagkkfids
ltlishlanigdartlaihpastthqqlteeeqlktgvtpdmirlsvgiedvediiadld
qalrksqe

SCOPe Domain Coordinates for d7kb1c_:

Click to download the PDB-style file with coordinates for d7kb1c_.
(The format of our PDB-style files is described here.)

Timeline for d7kb1c_: