SCOPe 2.07: Domain d7jr8b1: 7jr8 B:1-75

Lineage for d7jr8b1 (7jr8 B:1-75)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89705] (15 PDB entries)
   Uniprot O60760
   synonym: hematopoietic prostaglandin D synthase

8. Domain d7jr8b1: 7jr8 B:1-75 [405363]
   Other proteins in same PDB: d7jr8a2, d7jr8a3, d7jr8b2, d7jr8b3
   automated match to d1pd212
   complexed with cl, edo, gsh, mg, na, vh7

Details for d7jr8b1

PDB Entry: 7jr8, 1.13 Å

PDB Description: h-pdgs complexed with a 2-phenylimidazo[1,2-a]pyridine-6-carboxamide inhibitors

PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d7jr8b1:

Sequence; same for both SEQRES and ATOM records:

>d7jr8b1 c.47.1.5 (B:1-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
lhqslaiaryltknt

Timeline for d7jr8b1:

• d7jr8b1 is new in SCOPe 2.07-stable
  
• d7jr8b1 appears in the current release, SCOPe 2.08