Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (48 species) not a true protein |
Species Providencia stuartii [TaxId:588] [331391] (6 PDB entries) |
Domain d7jzsa1: 7jzs A:2-178 [405341] Other proteins in same PDB: d7jzsa2 automated match to d5us1d_ complexed with coa, peg, so4 |
PDB Entry: 7jzs (more details), 1.3 Å
SCOPe Domain Sequences for d7jzsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jzsa1 d.108.1.0 (A:2-178) automated matches {Providencia stuartii [TaxId: 588]} gieyrslhtsqltlsekealydlliegfegdfshddfahtlggmhvmafdqqklvghvai iqrhmaldntpisvgyveamvveqsyrrqgigrqlmlqtnkiiascyqlgllsasddgqk lyhsvgwqiwkgklfelkqgsyirsieeeggvmgwkadgevdftaslycdfrggdqw
Timeline for d7jzsa1: