Lineage for d7jzsa1 (7jzs A:2-178)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575922Species Providencia stuartii [TaxId:588] [331391] (6 PDB entries)
  8. 2575923Domain d7jzsa1: 7jzs A:2-178 [405341]
    Other proteins in same PDB: d7jzsa2
    automated match to d5us1d_
    complexed with coa, peg, so4

Details for d7jzsa1

PDB Entry: 7jzs (more details), 1.3 Å

PDB Description: aminoglycoside n-2'-acetyltransferase-ia [aac(2')-ia] in complex with coa
PDB Compounds: (A:) Aminoglycoside 2'-N-acetyltransferase

SCOPe Domain Sequences for d7jzsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jzsa1 d.108.1.0 (A:2-178) automated matches {Providencia stuartii [TaxId: 588]}
gieyrslhtsqltlsekealydlliegfegdfshddfahtlggmhvmafdqqklvghvai
iqrhmaldntpisvgyveamvveqsyrrqgigrqlmlqtnkiiascyqlgllsasddgqk
lyhsvgwqiwkgklfelkqgsyirsieeeggvmgwkadgevdftaslycdfrggdqw

SCOPe Domain Coordinates for d7jzsa1:

Click to download the PDB-style file with coordinates for d7jzsa1.
(The format of our PDB-style files is described here.)

Timeline for d7jzsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7jzsa2