Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Neurospora crassa [TaxId:367110] [405314] (1 PDB entry) |
Domain d7ep8a1: 7ep8 A:1-126 [405315] automated match to d5tupa1 |
PDB Entry: 7ep8 (more details), 1.95 Å
SCOPe Domain Sequences for d7ep8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ep8a1 d.131.1.0 (A:1-126) automated matches {Neurospora crassa [TaxId: 367110]} mlearleqasilkkvvdaikdlvqdcnfdcndsgialqamdnshvalvsmmlktetfspf rcdrnialgvnltsltkvlraaqnediltlkaedapdvlnlvfessendriseydlklmd idqehl
Timeline for d7ep8a1: