SCOPe 2.08: Domain d7epbd_: 7epb D:

Lineage for d7epbd_ (7epb D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d7epbd_: 7epb D: [405304]
   automated match to d4nbzb_
   complexed with 40f

Details for d7epbd_

PDB Entry: 7epb, 3.1 Å

PDB Description: cryo-em structure of ly354740-bound mglu2 homodimer

PDB Compounds: (D:) Anti-RON nanobody

SCOPe Domain Sequences for d7epbd_:

Sequence; same for both SEQRES and ATOM records:

>d7epbd_ b.1.1.0 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvqsggglvqaggslrlscaasvrffsintmgwyrqapgkqrelvaditssgstnya
dsgkgrftisrdnakntvylqmnrlkpedtavyychadykytthntawgqgtqvtvss

Timeline for d7epbd_:

• d7epbd_ first appeared in SCOPe 2.07