SCOPe 2.07: Domain d7equb_: 7equ B:

Lineage for d7equb_ (7equ B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53891] (20 PDB entries)

8. Domain d7equb_: 7equ B: [405289]
   automated match to d1nkxa_
   complexed with bct, fe, nag

Details for d7equb_

PDB Entry: 7equ, 2.74 Å

PDB Description: crystal structure of the c-lobe of lactoferrin produced by limited proteolysis using pepsin at 2.74a resolution

PDB Compounds: (B:) lactotransferrin

SCOPe Domain Sequences for d7equb_:

Sequence; same for both SEQRES and ATOM records:

>d7equb_ c.94.1.2 (B:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr

Timeline for d7equb_:

• d7equb_ is new in SCOPe 2.07-stable
  
• d7equb_ appears in the current release, SCOPe 2.08